MitoProteome Database

MT000164

Record overview

MITO ID	MT000164
Gene ID	1545
Species	Homo sapiens (Human)
Gene Name	cytochrome P450, family 1, subfamily B, polypeptide 1
Gene Symbol	CYP1B1
Synonyms	CP1B; GLC3A; CYPIB1; P4501B1;
Alternate names	cytochrome P450 1B1; microsomal monooxygenase; xenobiotic monooxygenase; aryl hydrocarbon hydroxylase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily I (dioxin-inducible), polypeptide 1 (glaucoma 3, primary infantile);
Chromosome	2
Map Location	2p22.2
EC Number	1.14.14.1
Summary	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for CYP1B1

Proteins

cytochrome P450 1B1

Refseq ID:	NP_000095
Protein GI:	189491763
UniProt ID:	Q16678
mRNA ID:	NM_000104
Length:	543
RefSeq Status:

MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLIGNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGE
RAIHQALVQQGSAFADRPAFASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVALLVRGSADGAFLDPRPLTVVA
VANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA
EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAELDQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIP
HATTANTSVLGYHIPKDTVVFVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEP
AKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETCQ