MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MT000196

Record overview

MITO IDMT000196
Gene ID1869
SpeciesHomo sapiens (Human)
Gene NameE2F transcription factor 1
Gene SymbolE2F1
SynonymsRBP3; E2F-1; RBAP1; RBBP3;
Alternate namestranscription factor E2F1; PBR3; RBAP-1; RBBP-3; PRB-binding protein E2F-1; retinoblastoma-binding protein 3; retinoblastoma-associated protein 1;
Chromosome20
Map Location20q11.2
SummaryThe protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for E2F1

Proteins

transcription factor E2F1
Refseq ID:NP_005216
Protein GI:12669911
UniProt ID:Q01094
mRNA ID:NM_005225
Length:437
RefSeq Status:
MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQY
LAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVG
GRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFI
SLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF