MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000720

Record overview

MITO ID	MT000720
Gene ID	9551
Species	Homo sapiens (Human)
Gene Name	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2
Gene Symbol	ATP5J2
Synonyms	ATP5JL;
Alternate names	ATP synthase subunit f, mitochondrial; F1F0-type ATPase subunit f; F1Fo-ATPase synthase f subunit; ATP synthase f chain, mitochondrial; F1Fo-ATP synthase complex Fo membrane domain f subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2;
Chromosome	7
Map Location	7q22.1
Summary	Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The catalytic portion of mitochondrial ATP synthase consists of five different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The proton channel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the f subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. This gene has multiple pseudogenes. Naturally occurring read-through transcription also exists between this gene and the downstream pentatricopeptide repeat domain 1 (PTCD1) gene. [provided by RefSeq, Nov 2010]
Orthologs	View orthologs and multiple alignments for ATP5J2

Proteins

ATP synthase subunit f, mitochondrial isoform 2a

Refseq ID:	NP_004880
Protein GI:	4757812
UniProt ID:	P56134
mRNA ID:	NM_004889
Length:	94
RefSeq Status:

ATP synthase subunit f, mitochondrial isoform 2b
`MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH`

Refseq ID:	NP_001003713
Protein GI:	51479129
UniProt ID:	P56134
mRNA ID:	NM_001003713
Length:	88
RefSeq Status:

ATP synthase subunit f, mitochondrial isoform 2c
`MASVVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH`

Refseq ID:	NP_001003714
Protein GI:	51479132
UniProt ID:	P56134
mRNA ID:	NM_001003714
Length:	55
RefSeq Status:

ATP synthase subunit f, mitochondrial isoform 2d
`MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQREHERLRKYH`

Refseq ID:	NP_001034267
Protein GI:	85794908
UniProt ID:	P56134
mRNA ID:	NM_001039178
Length:	49
RefSeq Status:

`MASVVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQREHERLRKYH`