MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000743

Record overview

MITO ID	MT000743
Gene ID	10017
Species	Homo sapiens (Human)
Gene Name	BCL2-like 10 (apoptosis facilitator)
Gene Symbol	BCL2L10
Synonyms	Boo; Diva; BCL-B;
Alternate names	bcl-2-like protein 10; bcl2-L-10; apoptosis regulator Bcl-B; anti-apoptotic protein NrH;
Chromosome	15
Map Location	15q21
Summary	The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains conserved BH4, BH1 and BH2 domains. This protein can interact with other members of BCL-2 protein family including BCL2, BCL2L1/BCL-X(L), and BAX. Overexpression of this gene has been shown to suppress cell apoptosis possibly through the prevention of cytochrome C release from the mitochondria, and thus activating caspase-3 activation. The mouse counterpart of this protein is found to interact with Apaf1 and forms a protein complex with Caspase 9, which suggests the involvement of this protein in APAF1 and CASPASE 9 related apoptotic pathway. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for BCL2L10

Proteins

bcl-2-like protein 10

Refseq ID:	NP_065129
Protein GI:	9966783
UniProt ID:	Q9HD36
mRNA ID:	NM_020396
Length:	204
RefSeq Status:

`MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTL VTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLW TRLL`