MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MT000790

Record overview

MITO IDMT000790
Gene ID10550
SpeciesHomo sapiens (Human)
Gene NameADP-ribosylation factor-like 6 interacting protein 5
Gene SymbolARL6IP5
SynonymsJWA; jmx; hp22; PRAF3; DERP11; HSPC127; addicsin; GTRAP3-18;
Alternate namesPRA1 family protein 3; JM5; aip-5; protein JWa; PRA1 domain family 3; ARL-6-interacting protein 5; dermal papilla derived protein 11; dermal papilla-derived protein 11; prenylated Rab acceptor protein 2; putative MAPK activating protein PM27; putative MAPK-activating protein PM27; glutamate transporter EEAC1-associated protein; glutamate transporter EAAC1-interacting protein; cytoskeleton related vitamin A responsive protein; cytoskeleton-related vitamin A-responsive protein; ADP-ribosylation-like factor 6 interacting protein 5; ADP-ribosylation factor-like protein 6-interacting protein 5;
Chromosome3
Map Location3p14
SummaryExpression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for ARL6IP5

Proteins

PRA1 family protein 3
Refseq ID:NP_006398
Protein GI:5453704
UniProt ID:O75915
mRNA ID:NM_006407
Length:188
RefSeq Status:
MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTT
FVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE