MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000836

Record overview

MITO ID	MT000836
Gene ID	11067
Species	Homo sapiens (Human)
Gene Name	chromosome 10 open reading frame 10
Gene Symbol	C10orf10
Synonyms	FIG; DEPP; Fseg;
Alternate names	protein DEPP; fasting induced; fat-specific expressed; fasting-induced protein; fasting-induced gene protein; decidual protein induced by progesterone;
Chromosome	10
Map Location	10q11.21
Summary	The expression of this gene is induced by fasting as well as by progesterone. The protein encoded by this gene contains a t-synaptosome-associated protein receptor (SNARE) coiled-coil homology domain and a peroxisomal targeting signal. Production of the encoded protein leads to phosphorylation and activation of the transcription factor ELK1. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for C10orf10

Proteins

protein DEPP

Refseq ID:	NP_008952
Protein GI:	5901938
UniProt ID:	Q9NTK1
mRNA ID:	NM_007021
Length:	212
RefSeq Status:

`MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMAD TVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLR TLYSHLPVIHEL`