MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000976

Record overview

MITO ID	MT000976
Gene ID	28958
Species	Homo sapiens (Human)
Gene Name	cytochrome c oxidase assembly factor 3
Gene Symbol	COA3
Synonyms	CCDC56; HSPC009; MITRAC12;
Alternate names	cytochrome c oxidase assembly factor 3 homolog, mitochondrial; coiled-coil domain-containing protein 56; cytochrome C oxidase assembly factor 3 homolog, mitochondrial; cytochrome c oxidase assembly protein 3 homolog, mitochondrial; mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa;
Chromosome	17
Map Location	17q21
Summary	This gene encodes a member of the cytochrome c oxidase assembly factor family. Studies of a related gene in fly suggest that the encoded protein is localized to mitochondria and is essential for cytochrome c oxidase function. [provided by RefSeq, Nov 2012]
Orthologs	View orthologs and multiple alignments for COA3

Proteins

cytochrome c oxidase assembly factor 3 homolog, mitochondrial

Refseq ID:	NP_001035521
Protein GI:	94536771
UniProt ID:	Q9Y2R0
mRNA ID:	NM_001040431
Length:	106
RefSeq Status:

`MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARAL ARASGS`