MitoProteome Database

MT001178

Record overview

MITO ID	MT001178
Gene ID	55794
Species	Homo sapiens (Human)
Gene Name	DEAD (Asp-Glu-Ala-Asp) box polypeptide 28
Gene Symbol	DDX28
Synonyms	MDDX28;
Alternate names	probable ATP-dependent RNA helicase DDX28; mitochondrial DEAD box protein 28; mitochondrial DEAD-box polypeptide 28; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 28;
Chromosome	16
Map Location	16q22.1
EC Number	3.6.4.13
Summary	DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene is intronless. It encodes an RNA-dependent ATPase. The encoded protein is localized in the mitochondria and the nucleus, and can be transported between the mitochondria and the nucleus. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for DDX28

Proteins

probable ATP-dependent RNA helicase DDX28

Refseq ID:	NP_060850
Protein GI:	256773275
UniProt ID:	Q9NUL7
mRNA ID:	NM_018380
Length:	540
RefSeq Status:

MALTRPVRLFSLVTRLLLAPRRGLTVRSPDEPLPVVRIPVALQRQLEQRQSRRRNLPRPVLVRPGPLLVSARRPELNQPARLTLGRWERAPLASQGWKSR
RARRDHFSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQSSTIPSLLRGRHVVCAAETGSGKTLSYLLPLLQRLLGQPSLDSLP
IPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRIRLQLSRQPSADVLVATPGALWKALKSRLISLEQLSFLVLDEADTLLDESFLELV
DYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHCIMPHVKQTFLRLKGADKVAELVHILKHRDRAERTGPSGTV
LVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIFQSFQKSSRDILLCTDIASRGLDSTGVELVVNYDFPPTLQDYIHRAGRVGRVGSEVPGTVI
SFVTHPWDVSLVQKIELAARRRRSLPGLASSVKEPLPQAT