MitoProteome Database

MT001191

Record overview

MITO ID	MT001191
Gene ID	56474
Species	Homo sapiens (Human)
Gene Name	CTP synthase 2
Gene Symbol	CTPS2
Alternate names	CTP synthase 2; CTP synthase II; UTP-ammonia ligase 2; CTP synthetase type 2; cytidine 5'-triphosphate synthetase 2;
Chromosome	X
Map Location	Xp22
EC Number	6.3.4.2
Summary	The protein encoded by this gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamine to glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play an important role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA. Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein. Thus, this protein is an attractive target for selective chemotherapy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Orthologs	View orthologs and multiple alignments for CTPS2

Proteins

CTP synthase 2

Refseq ID:	NP_001137474
Protein GI:	221316689
UniProt ID:	Q9NRF8
mRNA ID:	NM_001144002
Length:	586
RefSeq Status:

MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINK
ERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNS
VRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICS
IALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETEDPVKFHEAWQKLCKADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGVCL
GMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFV
GQDVDGDRMEIIELANHPYFVGVQFHPEFSSRPMKPSPPYLGLLLAATGNLNAYLQQGCKLSSSDRYSDASDDSFSEPRIAELEIS

CTP synthase 2

Refseq ID:	NP_787055
Protein GI:	28559085
UniProt ID:	Q9NRF8
mRNA ID:	NM_175859
Length:	586
RefSeq Status:

CTP synthase 2
Protein sequence is identical to GI:221316689 (mRNA isoform)

Refseq ID:	NP_062831
Protein GI:	28559083
UniProt ID:	Q9NRF8
mRNA ID:	NM_019857
Length:	586
RefSeq Status:

Protein sequence is identical to GI:221316689 (mRNA isoform)