MitoProteome Database

MT001307

Record overview

MITO ID	MT001307
Gene ID	79135
Species	Homo sapiens (Human)
Gene Name	apolipoprotein O
Gene Symbol	APOO
Synonyms	My025; FAM121B;
Alternate names	apolipoprotein O; brain my025; family with sequence similarity 121B;
Chromosome	X
Map Location	Xp22.11
Summary	This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16.[provided by RefSeq, Sep 2009]
Orthologs	View orthologs and multiple alignments for APOO

Proteins

apolipoprotein O precursor

Refseq ID:	NP_077027
Protein GI:	13129148
UniProt ID:	Q9BUR5
mRNA ID:	NM_024122
Length:	198
RefSeq Status:

`MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHYCEPYTTWCQETYSQTKPKMQSLVQWGLDSY DYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK`

N
sig_peptide: 1..23
calculated_mol_wt: 2556
peptide sequence: 
MFKVIQRSVGPASLSLLTFKVYA

mat_peptide: 24..198
product: apolipoprotein O
calculated_mol_wt: 19747
peptide sequence: 
APKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHYCEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLI
GLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK