MitoProteome Database

MT001435

Record overview

MITO ID	MT001435
Gene ID	84938
Species	Homo sapiens (Human)
Gene Name	autophagy related 4C, cysteine peptidase
Gene Symbol	ATG4C
Synonyms	APG4C; AUTL1; AUTL3; APG4-C;
Alternate names	cysteine protease ATG4C; autophagin-3; APG4 autophagy 4 homolog C; AUT-like 3 cysteine endopeptidase; ATG4 autophagy related 4 homolog C; AUT-like 1, cysteine endopeptidase; autophagy-related protein 4 homolog C; autophagy-related cysteine endopeptidase 3;
Chromosome	1
Map Location	1p31.3
EC Number	3.4.22.-
Summary	Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for ATG4C

Proteins

cysteine protease ATG4C

Refseq ID:	NP_116241
Protein GI:	30410844
UniProt ID:	Q96DT6
mRNA ID:	NM_032852
Length:	458
RefSeq Status:

MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEG
SALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKI
ISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGE
RTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEE
ITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL

cysteine protease ATG4C

Refseq ID:	NP_835739
Protein GI:	30410846
UniProt ID:	Q96DT6
mRNA ID:	NM_178221
Length:	458
RefSeq Status:

Protein sequence is identical to GI:30410844 (mRNA isoform)