MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT001599

Record overview

MITO ID	MT001599
Gene ID	221120
Species	Homo sapiens (Human)
Gene Name	alkB, alkylation repair homolog 3 (E. coli)
Gene Symbol	ALKBH3
Synonyms	ABH3; PCA1; DEPC1; DEPC-1;
Alternate names	alpha-ketoglutarate-dependent dioxygenase alkB homolog 3; prostate cancer antigen 1; prostate cancer antigen-1; alkylated DNA repair protein alkB homolog 3;
Chromosome	11
Map Location	11p11.2
EC Number	1.14.11.-
Summary	The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008]
Orthologs	View orthologs and multiple alignments for ALKBH3

Proteins

alpha-ketoglutarate-dependent dioxygenase alkB homolog 3

Refseq ID:	NP_631917
Protein GI:	21040275
UniProt ID:	Q96Q83
mRNA ID:	NM_139178
Length:	286
RefSeq Status:

`MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDVK EADWILEQLCQDVPWKQRTGIREDITYQQPRLTAWYGELPYTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGR CPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW`