MitoProteome Database

MT001693

Record overview

MITO ID	MT001693
Gene ID	100133941
Species	Homo sapiens (Human)
Gene Name	CD24 molecule
Gene Symbol	CD24
Synonyms	CD24A;
Alternate names	signal transducer CD24; CD24 antigen (small cell lung carcinoma cluster 4 antigen);
Chromosome	6
Map Location	6q21
Summary	This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and B cells and modulates growth and differentiation signals to these cells. The precursor protein is cleaved to a short 32 amino acid mature peptide which is anchored via a glycosyl phosphatidylinositol (GPI) link to the cell surface. This gene was missing from previous genome assemblies, but is properly located on chromosome 6. Non-transcribed pseudogenes have been designated on chromosomes 1, 15, 20, and Y. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Orthologs	View orthologs and multiple alignments for CD24

Proteins

signal transducer CD24 isoform a preproprotein

Refseq ID:	NP_001278666
Protein GI:	619329006
UniProt ID:	P25063
mRNA ID:	NM_001291737
Length:	80
RefSeq Status:

`MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS`

N
sig_peptide: 1..26
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2785
peptide sequence: 
MGRAMVARLGLGLLLLALLLPTQIYS

mat_peptide: 27..59
product: Signal transducer CD24
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P25063.2)
calculated_mol_wt: 3128
peptide sequence: 
SETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG

sig_peptide: 1..26
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2785
peptide sequence: 
MGRAMVARLGLGLLLLALLLPTQIYS

mat_peptide: 27..59
product: Signal transducer CD24
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P25063.2)
calculated_mol_wt: 3128
peptide sequence: 
SETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG

signal transducer CD24 isoform a preproprotein

Refseq ID:	NP_037362
Protein GI:	7019343
UniProt ID:	P25063
mRNA ID:	NM_013230
Length:	80
RefSeq Status:

Protein sequence is identical to GI:619329006 (mRNA isoform)

N
sig_peptide: 1..26
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2785
peptide sequence: 
MGRAMVARLGLGLLLLALLLPTQIYS

mat_peptide: 27..59
product: Signal transducer CD24
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P25063.2)
calculated_mol_wt: 3128
peptide sequence: 
SETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG

sig_peptide: 1..26
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2785
peptide sequence: 
MGRAMVARLGLGLLLLALLLPTQIYS

mat_peptide: 27..59
product: Signal transducer CD24
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P25063.2)
calculated_mol_wt: 3128
peptide sequence: 
SETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG

sig_peptide: 1..26
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2785
peptide sequence: 
MGRAMVARLGLGLLLLALLLPTQIYS

mat_peptide: 27..59
product: Signal transducer CD24
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P25063.2)
calculated_mol_wt: 3128
peptide sequence: 
SETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG

signal transducer CD24 isoform a preproprotein

Refseq ID:	NP_001278667
Protein GI:	619329008
UniProt ID:	P25063
mRNA ID:	NM_001291738
Length:	80
RefSeq Status:

Protein sequence is identical to GI:619329006 (mRNA isoform)

N
sig_peptide: 1..26
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2785
peptide sequence: 
MGRAMVARLGLGLLLLALLLPTQIYS

mat_peptide: 27..59
product: Signal transducer CD24
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P25063.2)
calculated_mol_wt: 3128
peptide sequence: 
SETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG

signal transducer CD24 isoform b

Refseq ID:	NP_001278668
Protein GI:	619329010
UniProt ID:
mRNA ID:	NM_001291739
Length:	129
RefSeq Status:

`MVGRFCPESPPGFVRVAATSAVSLDPPSGEPRPGCGYPGPRSAASRVYGCTAPARETGGWAWETLAGAGAKKIYSSETTTGTSSNSSQSTSNSGLAPNPT NATTKAAGGALQSTASLFVVSLSLLHLYS`

N
sig_peptide: 1..26
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2785
peptide sequence: 
MGRAMVARLGLGLLLLALLLPTQIYS

mat_peptide: 27..59
product: Signal transducer CD24
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P25063.2)
calculated_mol_wt: 3128
peptide sequence: 
SETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG

sig_peptide: 1..26
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2785
peptide sequence: 
MGRAMVARLGLGLLLLALLLPTQIYS

mat_peptide: 27..59
product: Signal transducer CD24
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P25063.2)
calculated_mol_wt: 3128
peptide sequence: 
SETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG

sig_peptide: 1..26
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2785
peptide sequence: 
MGRAMVARLGLGLLLLALLLPTQIYS

mat_peptide: 27..59
product: Signal transducer CD24
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P25063.2)
calculated_mol_wt: 3128
peptide sequence: 
SETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG