MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT001081

Record overview

MITO ID	MT001081
Gene ID	54205
Species	Homo sapiens (Human)
Gene Name	cytochrome c, somatic
Gene Symbol	CYCS
Synonyms	CYC; HCS; THC4;
Alternate names	cytochrome c;
Chromosome	7
Map Location	7p15.3
Summary	This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.[provided by RefSeq, Jul 2010]
Orthologs	View orthologs and multiple alignments for CYCS

Proteins

cytochrome c

Refseq ID:	NP_061820
Protein GI:	11128019
UniProt ID:	P99999
mRNA ID:	NM_018947
Length:	105
RefSeq Status:

`MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLK KATNE`